PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00934.1.g00110.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 477aa    MW: 51738.7 Da    PI: 5.4077
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00934.1.g00110.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.6e-19259312356
                                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Zpz_sc00934.1.g00110.1.am.mk 259 KKRRLSTEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 312
                                   45689************************************************9 PP

2HD-ZIP_I/II132.21.9e-42258350193
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   ekkrrls+eqv++LE+sFe+e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy aL+++ydal++++++L+
  Zpz_sc00934.1.g00110.1.am.mk 258 EKKRRLSTEQVRALERSFETENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYVALRQSYDALRADHDALR 338
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelke 93 
                                   +++++L +e+ke
  Zpz_sc00934.1.g00110.1.am.mk 339 RDKDALLAEIKE 350
                                   *******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.13E-19254316IPR009057Homeodomain-like
PROSITE profilePS5007117.621254314IPR001356Homeobox domain
SMARTSM003892.0E-18257318IPR001356Homeobox domain
PfamPF000463.6E-16259312IPR001356Homeobox domain
CDDcd000863.31E-17259315No hitNo description
Gene3DG3DSA:1.10.10.601.3E-19261320IPR009057Homeodomain-like
PRINTSPR000312.4E-5285294IPR000047Helix-turn-helix motif
PROSITE patternPS000270289312IPR017970Homeobox, conserved site
PRINTSPR000312.4E-5294310IPR000047Helix-turn-helix motif
PfamPF021831.4E-16314355IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MSSRPGPLAH GVTGVTGEYV LPLARSANCN EASNWLTDAG TRIANPHKTS QEFTARHGSP  60
FTDPVHPARP CFSPVHRAPR RSHRTTTVEA DARARDLLNH GHVLPPGPES TRQLCAVLLG  120
GGVWIGAEEE DKHGDGPGWA QLQEGREGRR EPSPDAPFLV PLRPAAPPLI TLRAKKQFIM  180
KRPSGSRSGG GDGLVSMVQS GKIFLVISPV FFLSAATRRC GLRERDVGFA CTDDRFVDVA  240
VEEEADEDTE IPVGGGGEKK RRLSTEQVRA LERSFETENK LEPERKARLA RDLGLQPRQV  300
AVWFQNRRAR WKTKQLERDY VALRQSYDAL RADHDALRRD KDALLAEIKE LNAKLGDEDA  360
AASFSSVKEE PVASDADPPP AATAAQGSSE SDSSGVVNDT ETASEKKPAP TNAAEAEAVV  420
PGATALEGEV LFHAQLLKVE GDEAAFLDDD AAACGGFFAD LQPPSLPWWT EPMEHWA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1283289ERKARLA
2306314RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D3H1F81e-111A0A0D3H1F8_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.19e-44homeobox protein 16